Protein Sequence of the antigen NP_064909.1 putative viral membrane protein [Amsacta moorei entomopoxvirus]
MDNTILQIGEKNIDYYRSAASKLKTFKGYMGYILTIIFIIISTIFFILQSFRWEPLVQLDKFRRIKKNIGSWKQLVLEKTQIEMTRGRARSLQLVNDAFTYRCYDFGNYYAAMRMNQTTFLPEFILRGIGDVWRFRKAAERDVPASQFCEYIVWTNNSNSAQCGIDMFNKLGYSGYFEFSHPCQTALNILSNNNI
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MDNTILQIGEKNID | 1.0 | 1 | 14 |
| 2 | YYRSAASKLKTFK | 0.9999993 | 15 | 27 |
| 3 | GYMGYILTIIFII | 1.0 | 28 | 40 |
| 4 | EPLVQLDKFRR | 1.0 | 54 | 64 |
| 5 | IKKNIGSWK | 0.97136426 | 65 | 73 |
| 6 | QLVLEKTQIEMT | 0.9980087 | 74 | 85 |
| 7 | AFTYRCYDF | 1.0 | 98 | 106 |
| 8 | GNYYAAMRMNQ | 0.9999876 | 107 | 117 |
| 9 | TTFLPEFIL | 0.99817324 | 118 | 126 |
| 10 | RGIGDVWRFRKAA | 1.0 | 127 | 139 |
| 11 | LGYSGYFEFS | 1.0 | 171 | 180 |