Protein Sequence of the antigen NP_064898.1 hypothetical protein AMV116 [Amsacta moorei entomopoxvirus]
MIDKILKISNKYGLNVNEYYIKNIIKYNDNIRYCILLDKEESLSLFNKKINLTDTIILYLQMKFEESDIVNLFIIDVIKLLKDKIEIYFIHNVPFSIYNIVNDKNKYYIETNKNNLDESILLYNYMIEFLS
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | GLNVNEYYIK | 1.0 | 13 | 22 |
| 2 | LLDKEESLSLF | 1.0 | 36 | 46 |
| 3 | NKKINLTDTIILY | 0.9999919 | 47 | 59 |
| 4 | LQMKFEESD | 0.9999999 | 60 | 68 |
| 5 | NDKNKYYIETNK | 0.98795295 | 102 | 113 |
| 6 | NNLDESILLYN | 1.0 | 114 | 124 |