Protein Sequence of the antigen NP_064868.1 hypothetical protein AMV086 [Amsacta moorei entomopoxvirus]
MELKSDLIFTDTIYSEIIISKNLSKKDLKIEYSNLYTEILLRQKDGSLIEALRPNSNFFDQYDIESIKNTGIKFKPMVIKYHLTEDALYKISSFN
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MELKSDLIFTDTI | 0.9975046 | 1 | 13 |
| 2 | YSEIIISKN | 1.0 | 14 | 22 |
| 3 | LSKKDLKIEY | 0.9438371 | 23 | 32 |
| 4 | SNLYTEILL | 1.0 | 33 | 41 |
| 5 | RQKDGSLIEALRP | 1.0 | 42 | 54 |
| 6 | KNTGIKFKP | 0.999013 | 68 | 76 |