Protein Sequence of the antigen AUI80586.1 hypothetical protein [White-tailed deer poxvirus]

MELRSAIIAVLENINRYQFKMIIFITQDELRIEEEEKPTMDRIDLAEKLIKKYKDIRSLYFLLNIFREMPDTEFVKKQLSDYIKRFNRKYLEQNDTTFGKTQPTIKRKHRFRNMDVLKRLSCSEKRRLF

Download Epitopes

Epitope Number Epitope Epitope Prediction Score Epitope Start Epitope End
1 MELRSAIIAVLENI 0.98852384 1 14
2 NRYQFKMIIFI 1.0 15 25
3 TQDELRIEEEEKPT 0.9999485 26 39
4 MDRIDLAEKL 0.9112115 40 49
5 FLLNIFREM 1.0 61 69
6 SDYIKRFNRKY 1.0 80 90
7 FRNMDVLKRLS 0.9999707 111 121