Protein Sequence of the antigen AUI80586.1 hypothetical protein [White-tailed deer poxvirus]
MELRSAIIAVLENINRYQFKMIIFITQDELRIEEEEKPTMDRIDLAEKLIKKYKDIRSLYFLLNIFREMPDTEFVKKQLSDYIKRFNRKYLEQNDTTFGKTQPTIKRKHRFRNMDVLKRLSCSEKRRLF
| Epitope Number | Epitope | Epitope Prediction Score | Epitope Start | Epitope End |
|---|---|---|---|---|
| 1 | MELRSAIIAVLENI | 0.98852384 | 1 | 14 |
| 2 | NRYQFKMIIFI | 1.0 | 15 | 25 |
| 3 | TQDELRIEEEEKPT | 0.9999485 | 26 | 39 |
| 4 | MDRIDLAEKL | 0.9112115 | 40 | 49 |
| 5 | FLLNIFREM | 1.0 | 61 | 69 |
| 6 | SDYIKRFNRKY | 1.0 | 80 | 90 |
| 7 | FRNMDVLKRLS | 0.9999707 | 111 | 121 |